Protein Info for ABID97_RS00945 in Variovorax sp. OAS795

Annotation: molecular chaperone HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 PF13589: HATPase_c_3" amino acids 32 to 147 (116 residues), 28.1 bits, see alignment E=1.9e-10 PF00183: HSP90" amino acids 225 to 677 (453 residues), 425.9 bits, see alignment E=3e-131

Best Hits

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 96% identity to vap:Vapar_4976)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>ABID97_RS00945 molecular chaperone HtpG (Variovorax sp. OAS795)
MADSSNTKLPFQAEVAQLLHLVTHALYSNKEIFLRELISNASDACDKLRFEAIDRPELYE
DQPELDVRLSFDKAARTLTITDKGIGLSRQEAIDNLGTIAKSGTKDFMSKLSGDQKADAQ
LIGQFGVGFYSGFIVADRITVESRRAGLPPEQGVRWASGGAGDFEVADITRAERGTSITL
HLREDADEYLNAWKLKQIVGKYSDHISLPILMEKEEWKEGENDQPGDMAKTGEWETVNKA
NALWSRNKKDIAPEQYEEFYKSISHDYESPLAWSHNRVEGSTEYTQLLYIPSKAPFDLWN
REKSAGVKLYVKRVFIMDDAEALLPSYLRFVKGVIDSSDLPLNVSRELLQESRDVKAIRE
GSTKRVLSMLEDLAKKQKTGPESGEGKIDVGSGESVPAPEPTEAVTDVVDKNAPTAAETA
AAAADESGKYAKFYAEFGAVLKEGLGEDFNNRDRIAKLLRFASTTSDTASVSFADYKARM
KEGQDAIYYITADTLAAARNSPQLEVFKKKGIEVLLMTDRVDEWALNYLTEFDGTPLQSV
AKGAVDLGKLQDEAEKKAAEEAAESFKPLLEKLKEALKDKAEDVRVTTRLVDSPACLVVQ
DGGMSTQLARMLKQAGQPAPDLKPVLEVNAEHALVKKLETSEHFDDLANILFDQALLAEG
GLPADPAAYVRRVNALLV