Protein Info for ABID97_RS00815 in Variovorax sp. OAS795

Annotation: crotonase/enoyl-CoA hydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 114 to 130 (17 residues), see Phobius details PF00378: ECH_1" amino acids 22 to 270 (249 residues), 133.6 bits, see alignment E=8.2e-43 PF16113: ECH_2" amino acids 24 to 243 (220 residues), 60.7 bits, see alignment E=1.9e-20

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 97% identity to vap:Vapar_4945)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>ABID97_RS00815 crotonase/enoyl-CoA hydratase family protein (Variovorax sp. OAS795)
MTAVPTTPPPEGCIDTQVIDHVLLIGINRPAKRNGWTPPMFRQLAEAYTRLDDDPGLRVG
VLHAFGDHFTAGLDLPAVTEYMKRGEKAIPAGLVEPHDFGLPGYRRRTKPMVAAVKGICF
TVGIELMLGADIVVAADDCRFSQMEVQRGIMATGGATLRMAERAGVGNAMLHLLTADEFD
SAEAYRLNFVQKVVPAGQELDAALAIAQRIAAQAPLAVVATRLNVIKAVEQGPLAAVSEF
IETQKRLSNSEDAAEGVRSFVERRPARFSGR