Protein Info for ABID97_RS00540 in Variovorax sp. OAS795

Annotation: HAMP domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF00672: HAMP" amino acids 195 to 244 (50 residues), 46.2 bits, see alignment 6.8e-16 PF00512: HisKA" amino acids 250 to 309 (60 residues), 39.5 bits, see alignment E=7.1e-14 PF02518: HATPase_c" amino acids 353 to 455 (103 residues), 74.7 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: None (inferred from 87% identity to vap:Vapar_4890)

Predicted SEED Role

"integral membrane sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABID97_RS00540 HAMP domain-containing sensor histidine kinase (Variovorax sp. OAS795)
MRSRRGDWRKAWREMGCRRAELHRQWHEQFHEKVQGKRRWRRSLRIRLVMMFLLLAVVMA
VVFMGGMKKSFSTGWAEAAKPMLVDYADRLVAEIGTPPDIARAQALVNRLPITIRIVGPK
VNWDSNPAGANGRGGWMQHLDEDPLNDKWFIRPTADGHRVVFGWAPKLWQLAPRAAGWAT
LCTLLLLMVLGYVYVSRLLRPLIDIREGAQRFGRGEFTQPIPIRQNDDLGDLAAHINTMA
DDIQAMLDAKRGLLLALSHELRSPLTRARLNAELLPATPEGAAEREALLRDLNEMRDLIS
DLLESERLASPHAALQREPVDLAVLVREIVAEMPGAQQVHLDLAERLPAHAVDRMRFRLL
LRNLLDNALRYSADAPRPPCVSLRAVVDGKDQGAELEIRDHGPGVDEAQLERLTEPFYRT
DGARARATGGVGLGMYLCRLIAEAHGGSLVVRNAHPGLQIVVRI