Protein Info for ABID97_RS00515 in Variovorax sp. OAS795

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 165 to 190 (26 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details PF03600: CitMHS" amino acids 28 to 311 (284 residues), 108.3 bits, see alignment E=4.5e-35 PF07854: DUF1646" amino acids 85 to 182 (98 residues), 22.8 bits, see alignment E=5.7e-09

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_4885)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>ABID97_RS00515 SLC13 family permease (Variovorax sp. OAS795)
MTSSAAEPSAAAPSEEGGGNGLLWLLAAVAVVFAFLRPRAPMDWLQLVDWQTVGALTGLL
AITQGVEKSGMLQAAAQRLLARTHSQRSLALLLTACAALLSALVTNDVSLFLLVPLTRVL
ANQAHLPLARLVVLEALAVNAGSALTPIGNPQNLYLWHRSGESFAAFMGMMLPTVAVMLF
WLFAAAWLLVPRTPIALKPEAETSPVQPRLLALAGVLFIGFVVALDRHWLLAGLGVVLAV
FLVTYPRVLRGIDWALLAIIALMFVDLRQLAELPAIVALLNHWPITEGWRAYLAAIVASQ
FISNVPAAILLDGHVRDLPALAAGVSVGGFGCVLGSLANLIALRLARVPHGLREFHRISI
PFLLVCAASALPLRLG