Protein Info for ABID97_RS00495 in Variovorax sp. OAS795

Annotation: DUF493 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF04359: DUF493" amino acids 19 to 102 (84 residues), 105.2 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 71% identical to Y4239_LEPCP: UPF0250 protein Lcho_4239 (Lcho_4239) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K09158, hypothetical protein (inferred from 91% identity to vpe:Varpa_5517)

Predicted SEED Role

"Proposed lipoate regulatory protein YbeD" in subsystem Lipoic acid metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>ABID97_RS00495 DUF493 family protein (Variovorax sp. OAS795)
MTENTTDPVTTPIPDPRKESLIEYPSQFPIKVMGVKADGFVHAITQIAERFDPAFDATTV
ELRDSKAGNYLGVTITVTATSREQLDDLYRALSAHPSVKVVL