Protein Info for ABID97_RS00465 in Variovorax sp. OAS795

Annotation: F0F1 ATP synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR01145: ATP synthase F1, delta subunit" amino acids 7 to 172 (166 residues), 119.2 bits, see alignment E=1.2e-38 PF00213: OSCP" amino acids 7 to 174 (168 residues), 153.3 bits, see alignment E=3.6e-49

Best Hits

Swiss-Prot: 94% identical to ATPD_VARPS: ATP synthase subunit delta (atpH) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 94% identity to vap:Vapar_4873)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>ABID97_RS00465 F0F1 ATP synthase subunit delta (Variovorax sp. OAS795)
MAELATIARPYAEALFKASSSDVAGTSAWLDQVAAIAASPELRQFADNPKATAEQVLGVI
AGAFGAPLTAHAQNFLGALLDNGRFTVLPEIAKQFRALANAKSGSSDAVVYSAFPIDAAA
LANVAAALEKRFGRKLQVTVQQEPDLIGGIRVVVGDEVLDTSVKARLEQMKVALAA