Protein Info for ABID97_RS00350 in Variovorax sp. OAS795

Annotation: nuclear transport factor 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF14534: DUF4440" amino acids 18 to 126 (109 residues), 39.5 bits, see alignment E=1.4e-13 PF13474: SnoaL_3" amino acids 21 to 133 (113 residues), 63 bits, see alignment E=6.9e-21 PF12680: SnoaL_2" amino acids 22 to 81 (60 residues), 34.4 bits, see alignment E=6e-12 PF08332: CaMKII_AD" amino acids 23 to 133 (111 residues), 26.7 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_4837)

Predicted SEED Role

"Alternative dihydrofolate reductase 3" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>ABID97_RS00350 nuclear transport factor 2 family protein (Variovorax sp. OAS795)
MPKTPLRAAAALGGTADDIEAAFYEALQRGDIDALMACWADEDEVFCVHPGGPRLVGATA
IRAAFEQMFGNGAIHATPARVRKIESLASAVHNVLERIEVLTAEGPKHAFVLATNVYHKT
VEGWRLVAHHASPGSAREPSDSNDTPQTLH