Protein Info for ABID97_RS00285 in Variovorax sp. OAS795

Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00590: TP_methylase" amino acids 29 to 235 (207 residues), 117.1 bits, see alignment E=1.1e-37 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 30 to 304 (275 residues), 230.7 bits, see alignment E=1.2e-72 PF23016: RsmI_C" amino acids 263 to 306 (44 residues), 64.8 bits, see alignment 5.1e-22

Best Hits

Swiss-Prot: 46% identical to RSMI_XYLFT: Ribosomal RNA small subunit methyltransferase I (rsmI) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07056, (no description) (inferred from 94% identity to vap:Vapar_4819)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABID97_RS00285 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (Variovorax sp. OAS795)
MASLAPASFGAALAAARDASGAQHYPQGTLYVVATPIGNLADITLRALHVLQLVDAVACE
DTRHTQSLLRAYGIDRPGGQLLAVHQHNEAEAAQAVVARLAQGERIAYVSDAGTPGVSDP
GARLVAAVRAAGQRVLPLPGASSVTTLVGAAGLVAAGDESSAFVFAGFLPTKAGERDAAV
QALAQERRAVVLLEAPHRIEAVARALAVLGERRITVGRELTKQFEEIVTVATAELPAWFA
AGRDRTRGEFALVLHPVAASTVDDGAEGERVLRLLMAELPVKTAVRLAAEISGAPRNALY
ETALRIRNDAGPADDDE