Protein Info for ABID97_RS00260 in Variovorax sp. OAS795

Annotation: PilT/PilU family type 4a pilus ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF00437: T2SSE" amino acids 8 to 278 (271 residues), 143.8 bits, see alignment E=2.9e-46 TIGR01420: twitching motility protein" amino acids 10 to 351 (342 residues), 449.7 bits, see alignment E=3.6e-139

Best Hits

Swiss-Prot: 45% identical to PILT_PSEAE: Twitching mobility protein (pilT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02670, twitching motility protein PilU (inferred from 98% identity to vpe:Varpa_5475)

Predicted SEED Role

"Twitching motility protein PilT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>ABID97_RS00260 PilT/PilU family type 4a pilus ATPase (Variovorax sp. OAS795)
MERDQASQFINDLLKLMVSRNGSDLFITADFPPAIKVDGKVTKVSQQALGAQHTLALTRS
VMNDRQTAEFERTKECNFAISPTGIGRFRVNAFVQQGKVGMVLRTIPAKLPTIDGLGMPQ
VLKDVSMTKRGLTIMVGATGSGKSTTLAAMIDWRNENSYGHIVTVEDPVEFVHPHKNCVV
TQREVGIDTDSWEAALKNTLRQAPDVILMGEIRDRETMEHAVAFAETGHLCMATLHANSA
NQALDRIINFFPEERRAQLLMDLSLNLRSLVSQRLIPTEDGLGRVAAVEVLLNTPLISDL
IFKGEVGEIKEIMRKSRNLGMQTFDQALFDLFESHSITFEDAIRNADSANDLRLQIKLNS
QRARSTDLAAGTEHFAIV