Protein Info for ABID97_RS00120 in Variovorax sp. OAS795

Annotation: AMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 17 to 402 (386 residues), 277.9 bits, E=1.2e-86
• PF13193: AMP-binding_C
  • amino acids 452 to 527 (76 residues), 81.1 bits, E=9.5e-27

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 89% identity to vap:Vapar_4793)

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate β-oxidation (29/35 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• octane oxidation (4/5 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• long-chain fatty acid activation (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• chitin deacetylation (2/4 steps found)
• phosphatidylcholine acyl editing (2/4 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• cis-geranyl-CoA degradation (3/9 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1, 6.2.1.3

Use Curated BLAST to search for 6.2.1.1 or 6.2.1.3

Protein Sequence (537 amino acids)

>ABID97_RS00120 AMP-binding protein (Variovorax sp. OAS795)
METLPDRPLKPLHEYLRAHARERGDRAACIWYGHAMTWAELDRASDAFAARLQAIGVRKG
EPVVLFLNNCPQYLVAHFGIQKIGAIVCPCSPLNKEHELGYQVNDLAARVIVAAAPLLPV
VRKVQPESALAHVFVVHYADLLPGQPTLDLPAELAAERSAARVVPSDCEDFLAVMQSGAV
PQPVAIDLDDVALMTYTSGTTGLPKGAMLSYGNALFKTRAASDCNSVASSDVLLSIPPLY
HIAGMLMGVNVPVLSGAASVLLHRFDPRAVLQAIAQYKVTWWYSIAPMNVACMQVPDIAN
FDLSSLRRNPVTSFGITFTESLAAQWRSHAPSCTSFEAAYGLSETHTCDTYTPHHSPRWG
TQGIAVPGVTIRIVDTETQADVPTGEVGEIVLTSPGCFKGYWNKPEATAATLRDGWVHTG
DIGKLDADGYLTFMGRIKEMIKVSGYSVFPEQVETILVKHPDVAQAAVIAQPDPEKGEVV
KAFIVRKPGATLDAETLMAWSRDNMASYKVPRAVSFIDALPTTGAGKVLRRLLKDKT