Protein Info for ABID97_RS00085 in Variovorax sp. OAS795

Annotation: AbrB family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 77 to 104 (28 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details PF05145: AbrB" amino acids 32 to 349 (318 residues), 256.7 bits, see alignment E=1.3e-80 TIGR03082: membrane protein AbrB duplication" amino acids 193 to 349 (157 residues), 122.8 bits, see alignment E=5.8e-40

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 91% identity to vap:Vapar_4786)

Predicted SEED Role

"Ammonia monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>ABID97_RS00085 AbrB family transcriptional regulator (Variovorax sp. OAS795)
MSFRFPVRVLATLLLALAAASLCLALRTPLPWMIGPLLAVSLASIAGAPTASHTPLRNAG
QWTIGTALGLYFTPQVVALVAGVWWAIAIAIAWALLLGCGFGRWLHRLHARRMPHVPARS
MRATTYFAGAIGGASEMTLLSESAGARTDLVAAAHSLRLVVVTIAIPFAMQWSGLHGIEI
NPPMVREVNAGGLLLLALATGAGGLAMRALGRTNPWFMGPLVVAMGFTIAGQPLSAVPTW
MSNAAQLVIAVSLGVRFSREFLHTAPRWLASVALGTAVMLVLCASAAWLLARAAGLHPAT
MILATSPGGIAEMSITAKVLQLGVPVVTAFQVCRLVAVLLLVGPMYRWIYGRK