Protein Info for ABI39_RS21270 in Phocaeicola dorei CL03T12C01

Annotation: HAMP domain-containing histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 368 to 476 (109 residues), 97.3 bits, see alignment E=7.9e-32

Best Hits

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>ABI39_RS21270 HAMP domain-containing histidine kinase (Phocaeicola dorei CL03T12C01)
MEKRIKTVWILTIITAILIIGGQGYWLHHQYCYSTRTFMQELHKQILQLEKEEMNTRYDK
RTNNHKYTLSYKIEMPDSVNQNGKTTCVISFYRQKSEINNLDSLIKQNALLNEESVIVRD
SFRVENISNEILFDAATRYGAEMTHPFRAEIFDSLLQANQIKLTNIRLMQTDSILWHGSY
TSSTRLFKPEMYIVYPYNPLLKQALTASIQIPFPSLLQQMAWQLLGSLILVLLLVFCLIY
QIKTILKQRKIDEMRKSFVNTMIHELKRPVQTLKMCIAFLNNKSMRTDERAMDEVVKDSM
FELDNLSAYLAKVRDMTRADYEHTPLHIRTFDLRETVNKLIRLTNIPADKQVTVHPHYKM
ESTLVIADPVHIANIISNLIENAIKYSGKEVRIDLSCIQKGHTLTIQITDNGIGIPPAEQ
SKVFDKFYRGSHIPDRNIPGIGLGLSYVKLLTEAHHGYVSLTSQPGKGTTFSIVLPQ