Protein Info for ABI39_RS20370 in Phocaeicola dorei CL03T12C01

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 69 to 97 (29 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 23 to 288 (266 residues), 297.3 bits, see alignment E=4.6e-93 PF00528: BPD_transp_1" amino acids 91 to 293 (203 residues), 90.2 bits, see alignment E=7.3e-30

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 98% identity to bvu:BVU_3938)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABI39_RS20370 phosphate ABC transporter permease PstA (Phocaeicola dorei CL03T12C01)
MKQDVFPARQGARKRRSQWLAFGIFKLLSYSIVLILFAILGFIIYKGIGVISWEFLTTAP
SDGMTGGGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRMMTNNLSG
IPSIVFGLFGMALFVKYMGFGDSILAGSLTLGLLCVPLVIRTTEEALKAIPDSFREGSLA
LGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPHSILDQCM
ALPYHLYVISTSGTDMESQLPLAYGTALVLIIIILIINLLANALRKYFSNKVKTN