Protein Info for ABI39_RS20365 in Phocaeicola dorei CL03T12C01

Annotation: phosphate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00972: phosphate ABC transporter, ATP-binding protein
  • amino acids 4 to 250 (247 residues), 407.8 bits, E=7.1e-127
• PF00005: ABC_tran
  • amino acids 19 to 174 (156 residues), 115.3 bits, E=3.4e-37

Best Hits

Swiss-Prot: 91% identical to PSTB_BACTN: Phosphate import ATP-binding protein PstB (pstB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 99% identity to bvu:BVU_3937)

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27

Protein Sequence (250 amino acids)

>ABI39_RS20365 phosphate ABC transporter ATP-binding protein (Phocaeicola dorei CL03T12C01)
MNKIDAKHVNFFYGDFQALKDISMTIEEKEVVAFIGPSGCGKSTFLRLFNRMNDLIPGSR
LEGEILIDGRNIYDKSVQVDELRKNVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNEFIR
HRVEETLKGAALWDEVKNKLKESAFALSGGQQQRLCIARAMAVSPSVLLMDEPASALDPI
STAKVEELIHELKKEYTIVIVTHNMQQAARVSDKTAFFYMGNMVEYDDTKKIFTNPGKEA
TQNYITGRFG