Protein Info for ABI39_RS20200 in Phocaeicola dorei CL03T12C01

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF05496: RuvB_N" amino acids 9 to 128 (120 residues), 58.6 bits, see alignment E=2.3e-19 PF07728: AAA_5" amino acids 42 to 128 (87 residues), 27.9 bits, see alignment E=7.4e-10 PF00004: AAA" amino acids 43 to 151 (109 residues), 65.9 bits, see alignment E=1.9e-21 PF16193: AAA_assoc_2" amino acids 177 to 252 (76 residues), 89.2 bits, see alignment E=6.1e-29 PF12002: MgsA_C" amino acids 253 to 419 (167 residues), 246.7 bits, see alignment E=4.1e-77

Best Hits

Swiss-Prot: 48% identical to RARA_COXBU: Replication-associated recombination protein A (rarA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K07478, putative ATPase (inferred from 99% identity to bvu:BVU_3911)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ABI39_RS20200 replication-associated recombination protein A (Phocaeicola dorei CL03T12C01)
MAQPLAERLRPKTLDDYIGQKHLVGPGAVLRKMIDAGRISSFILWGPPGVGKTTLAQIIA
NKLETPFYTLSAVTSGVKDVRDVIEKARSNRFFSQASPILFIDEIHRFSKSQQDSLLGAV
ETGVVTLIGATTENPSFEVIRPLLSRCQLYVLKSLEKEDLLELLHNAIAKDVILKEKKIE
LKETDAMLRFSGGDARKLLNILELVVEADADAGTIVITDEKVTERLQQNPLAYDKDGEMH
YDIISAFIKSIRGSDPDGALYWLARMVEAGEDPAFIARRLVISAAEDIGLANPNALLLAN
AAFDAVMKIGWPEGRIPLAEATVYLATSPKSNSAYEGINSALELVRQTGNLPVPLHLRNA
PTKLMKQLGYGKDYKYAHAYQGNFVQQQFLPDEVKGSRIWHPQNNAQEAKIKERMQSLWG
ERFKE