Protein Info for ABI39_RS18950 in Phocaeicola dorei CL03T12C01

Annotation: glycine cleavage system aminomethyltransferase GcvT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR00528: glycine cleavage system T protein" amino acids 2 to 360 (359 residues), 392.8 bits, see alignment E=6.8e-122 PF01571: GCV_T" amino acids 8 to 256 (249 residues), 303.9 bits, see alignment E=8e-95 PF08669: GCV_T_C" amino acids 282 to 359 (78 residues), 77.9 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 99% identical to GCST_BACV8: Aminomethyltransferase (gcvT) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 99% identity to bvu:BVU_3828)

MetaCyc: 41% identical to glycine cleavage system T-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>ABI39_RS18950 glycine cleavage system aminomethyltransferase GcvT (Phocaeicola dorei CL03T12C01)
MKTTPFTETHIALGAKMHEFAGYNMPIEYSGIIDEHLTVCNAVGVFDVSHMGEFWVKGPN
ALEFLQQVTSNNVATLPVGKAQYTCFPNEEGGIVDDLLVYHYESEKYLLVVNAANIEKDW
NWCVSHNTVSAELENASDHMAQLAIQGPKAMEVLQKLTPVDLSEIPYYAFTTGEFAGQKD
VIISNTGYTGAGGFELYFYPEAGQAIWKAIFEAGAPEGIKPIGLGARDTLRLEMGFCLYG
NDLSDTTSPLEAGLGWITKFVEGKNFISRALLEKQKAEGLKRKLIAFEMVDRGIPRHGYE
LVNADGEKIGEVTSGTMSPMRKIGIGMGYVQTAYTALGTEIFIDVRGRKLKAVIVKAPFR
K