Protein Info for ABI39_RS18950 in Phocaeicola dorei CL03T12C01

Annotation: glycine cleavage system aminomethyltransferase GcvT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00528: glycine cleavage system T protein
  • amino acids 2 to 360 (359 residues), 392.8 bits, E=6.8e-122
• PF01571: GCV_T
  • amino acids 8 to 256 (249 residues), 303.9 bits, E=8e-95
• PF08669: GCV_T_C
  • amino acids 282 to 359 (78 residues), 77.9 bits, E=4.3e-26

Best Hits

Swiss-Prot: 99% identical to GCST_BACV8: Aminomethyltransferase (gcvT) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 99% identity to bvu:BVU_3828)

MetaCyc: 41% identical to glycine cleavage system T-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate transformations I (9/13 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• photorespiration II (5/10 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 2.1.2.10

Protein Sequence (361 amino acids)

>ABI39_RS18950 glycine cleavage system aminomethyltransferase GcvT (Phocaeicola dorei CL03T12C01)
MKTTPFTETHIALGAKMHEFAGYNMPIEYSGIIDEHLTVCNAVGVFDVSHMGEFWVKGPN
ALEFLQQVTSNNVATLPVGKAQYTCFPNEEGGIVDDLLVYHYESEKYLLVVNAANIEKDW
NWCVSHNTVSAELENASDHMAQLAIQGPKAMEVLQKLTPVDLSEIPYYAFTTGEFAGQKD
VIISNTGYTGAGGFELYFYPEAGQAIWKAIFEAGAPEGIKPIGLGARDTLRLEMGFCLYG
NDLSDTTSPLEAGLGWITKFVEGKNFISRALLEKQKAEGLKRKLIAFEMVDRGIPRHGYE
LVNADGEKIGEVTSGTMSPMRKIGIGMGYVQTAYTALGTEIFIDVRGRKLKAVIVKAPFR
K