Protein Info for ABI39_RS18325 in Phocaeicola dorei CL03T12C01

Annotation: adenine nucleotide alpha hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01171: ATP_bind_3" amino acids 33 to 190 (158 residues), 61.3 bits, see alignment E=5.2e-21

Best Hits

Swiss-Prot: 34% identical to TTCA_PELPD: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)

KEGG orthology group: None (inferred from 96% identity to bvu:BVU_3645)

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>ABI39_RS18325 adenine nucleotide alpha hydrolase family protein (Phocaeicola dorei CL03T12C01)
MAQFTEDEKIMRRLEQRFNKGVVKYRLIEDGDKILIALSGGKDSLALLELLARRSRILKP
KFAVIAVHVSMTNIPYQSDLEYLKGYSEDLGVPFVHYETFFDLSTDTRKSPCFLCSWNRR
KALFTVAKEQGCNKIALGHHMDDILETLLMNITFQGAFSTMPPKLVMRKFEMTIIRPMCL
VHEADLIEMARILGFRKQIKNCPYESLSNRSNMKDVLYSLEKMNPEARYSLWRSMTNIQE
ELLPGMNEHDL