Protein Info for ABI39_RS17990 in Phocaeicola dorei CL03T12C01

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 143 to 161 (19 residues), see Phobius details PF00117: GATase" amino acids 7 to 80 (74 residues), 31.9 bits, see alignment E=3.8e-11 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 125 to 435 (311 residues), 453.9 bits, see alignment E=1.4e-140 PF00733: Asn_synthase" amino acids 135 to 163 (29 residues), 21.2 bits, see alignment (E = 7.6e-08) PF02540: NAD_synthase" amino acids 136 to 210 (75 residues), 28.9 bits, see alignment E=2.3e-10 PF03054: tRNA_Me_trans" amino acids 141 to 175 (35 residues), 22.8 bits, see alignment 2.3e-08 PF02568: ThiI" amino acids 141 to 197 (57 residues), 21.5 bits, see alignment 5.4e-08 PF00958: GMP_synt_C" amino acids 343 to 434 (92 residues), 122.7 bits, see alignment E=1.8e-39

Best Hits

Swiss-Prot: 90% identical to GUAA2_BACTN: Putative GMP synthase [glutamine-hydrolyzing] 2 (guaA2) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 99% identity to bvu:BVU_3588)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>ABI39_RS17990 glutamine-hydrolyzing GMP synthase (Phocaeicola dorei CL03T12C01)
MKQDMIVILDLGSTENTVLARAIRALGVYSEIYPHDITAAELKALPNVKGVIINGGPNHV
IDGVDIDVLPEIYKAGVPVMAAGHDKACCEVKLPQLTDDVEAIKNAVQSFVFDTCKAEAN
WNMTNFVNDQIELIRRQVGDKKVLLALSGGVDSSVVAALLLKAIGNNLVCVHVNHGLMRK
GESEAVIEVFKNQLNANLIYVDATDRFLSKLENVADPEQKRKIIGGEFIRVFEEEARKLN
GIDFLGQGTIYPDIVESGTKTAKMVKSHHNVGGLPEDLQFELVEPLRQLFKDEVRACGVE
LGLPYDMVYRQPFPGPGLGVRCLGAITRDRLETVRESDAILREEFQLAGLDKKVWQYFTV
VPNFKSVGVRDNARSFDWPVIIRAVNTVDAMTATIEPIDWSILMKITDRILKEVKNVNRV
CYDLSPKPNATIEWE