Protein Info for ABI39_RS17925 in Phocaeicola dorei CL03T12C01

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 24 to 368 (345 residues), 154.3 bits, see alignment E=2.3e-49

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 98% identity to bvu:BVU_3575)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>ABI39_RS17925 ABC transporter permease (Phocaeicola dorei CL03T12C01)
MKESPFIAVLKRELDRMVSRRIYFASCIVLPLFSIFFMATIFGNGQMENLPVGIVDGDNT
ATSREIIRMTEAVPTFRITRHYADEVEARADVQRKSIYGYLSIPSGFEAKVMDGKETALT
YYYHYALMSVGSEIHGAFQSLLKSISVVPIVTHAVALGINQEEIESFLLPVTTQNHPLFN
PDMDYSVYLTQPFFFVFLQVILLLVTTYSIGSEGKFHTSANWLAVADGNIWVAVTAKLLP
YSFIFIVMSILANYVFFGVMHIPMDCGFWALNFTSALLVIATQALAVFLFSLFPALSIII
SIVSMVGSLGATLGGVTFPVPHMFAPVYYASYLFPVRHFVEIGQNLLYGNYGYAYMWGNA
ACLLLFLIPPLLLLPHLKRSLISRKYDDIE