Protein Info for ABI39_RS17070 in Phocaeicola dorei CL03T12C01

Annotation: proline/glycine betaine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 132 to 159 (28 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 265 (163 residues), 99 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 52% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to bvu:BVU_3271)

Predicted SEED Role

"Glycine betaine ABC transport system, permease protein OpuAB" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>ABI39_RS17070 proline/glycine betaine ABC transporter permease (Phocaeicola dorei CL03T12C01)
MINIGKYIETAINWLTENFAPLFDAINVGIGGFIDGFQNILMWIPFYVTIALLAILAWYK
SGKGVSIFTILGLLLIWGMGFWNETMQTLALVLSSTIIALIMGLPLGIWSANSKRCDKIL
HPILDLMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTSLGIKQVPKNVIEA
SRSFGATPMQLLFKVQLPLALPTIMTGINQTILMSLSMVVIAAMIAAGGLGEIVLKGITQ
MKIGLGFEGGIAVVILAIILDRITQGLGKQKKGK