Protein Info for ABI39_RS17065 in Phocaeicola dorei CL03T12C01

Annotation: glycine betaine/L-proline ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 35 to 388 (354 residues), 427.5 bits, see alignment E=2.2e-132 PF00005: ABC_tran" amino acids 43 to 191 (149 residues), 127 bits, see alignment E=1.8e-40 PF00571: CBS" amino acids 294 to 324 (31 residues), 21.6 bits, see alignment (E = 4.6e-08) amino acids 338 to 388 (51 residues), 21.5 bits, see alignment 4.8e-08

Best Hits

Swiss-Prot: 50% identical to OPUAA_LACLA: Glycine betaine transport ATP-binding protein OpuAA (opuAA) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 100% identity to bvu:BVU_3270)

Predicted SEED Role

"Glycine betaine ABC transport system, ATP-binding protein OpuAA (EC 3.6.3.32)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.6.3.32)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ABI39_RS17065 glycine betaine/L-proline ABC transporter ATP-binding protein (Phocaeicola dorei CL03T12C01)
MNKIEIKDLYLVFGPEKQKAFRMLKERKSKNEILKATNCTVAVKNANLTIKEGEFFVIMG
LSGSGKSTLLRCINRLIKPTKGQVLINGTDITAASDKELLEMRRREIAMVFQNFGLLPHR
SVLSNIAFGLELQGVPKQEREKKAMKSMEIVGLKGYQNQMVGQLSGGMQQRVGLARALAN
DPEILLMDEAFSALDPLIRVQMQDEMLALQSKMKKTIVFITHDLSEAIKLGDRIAIMRDG
EVVQVGTSEEILTEPANDYVARFVENVDRSKIITAGSIMITRPAVARLRKEGPEVLIRKM
KERDITVLPVIDENDKLIGEITLESAAILRHKGIKSIKEAVQSEVHSVTEDTKIEDLLPL
ITKTNSPIYVVNEERELKGLVPLSSIVVEMTGKDKEEINELIQNAIEL