Protein Info for ABI39_RS16775 in Phocaeicola dorei CL03T12C01

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 66% identity to osp:Odosp_3005)

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
superpathway of fatty acid biosynthesis initiation (4/5 steps found)
fatty acid biosynthesis initiation (type II) (2/3 steps found)
streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABI39_RS16775 ketoacyl-ACP synthase III (Phocaeicola dorei CL03T12C01)
MVTSFNNKTISAVYSVLPSQEVDFLDEARNYSFSEAQMLKLKKVMGFGTRRVAKEGETVA
DYAIYGIQQMLNDGVFKEEEIGAIIVTTTSPDHFIPPVSNIIQGKFNFDEDTVCIDISQG
CCGYTVGLTYSFMTLNSIGNKKVLLVAGDMLSFKVSTRDRASRPIVGDGVSISVVENTTY
DNKVYCSLKNDGKDAFAVYIPAGGARMPITSENTVEEPDEFGNWRGKQHLVMQGDLVFNI
IINMTPVMIEELLDKANGKIEDIDYFICHQSSSFTLKKLAQRLGVSQERLPRDIVPKYGN
SSSASIPVTLCEHYDEMFADKDKQMIMFASFGTGMSLGAVYMEVPRFKDCKFIDYPHSI