Protein Info for ABI39_RS16730 in Phocaeicola dorei CL03T12C01
Annotation: lipopolysaccharide biosynthesis protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 61% identity to osp:Odosp_2994)MetaCyc: 42% identical to Escherichia coli O:113 antigen repeat unit flippase (Escherichia coli O113)
7.5.99.a [EC: 7.5.99.a]
Predicted SEED Role
"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis
MetaCyc Pathways
- Porphyromonas gingivalis O-LPS antigen biosynthesis (3/6 steps found)
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (2/5 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (2/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (2/6 steps found)
- Escherichia coli serotype O:15 O antigen biosynthesis (1/5 steps found)
- enterobacterial common antigen biosynthesis (1/5 steps found)
- Salmonella enterica serotype O:39 O antigen biosynthesis (2/7 steps found)
- Escherichia coli serotype O:149/Shigella boydii serotype O1 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:177 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:50 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:56 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:77/Salmonella enterica serotype O:6,14 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:13 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:111/Salmonella enterica serotype O:35 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:152 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:157/Salmonella enterica serotype O:30 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:1B/Salmonella enterica serotype O:42 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:2 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:71/Salmonella enterica serotype O:28ac O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:85/Salmonella enterica serotype O:17 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:18 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:6,7 O antigen biosynthesis (1/7 steps found)
- superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (2/9 steps found)
- Escherichia coli serotype O:104 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:107 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:117 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:127 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:128 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:21/Salmonella enterica serotype O:38 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:49 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:51/Salmonella enterica serotype O:57 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:55/Salmonella enterica serotype O:50 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:86 O antigen biosynthesis (1/8 steps found)
- Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
- Shigella boydii serotype 6 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:169 O antigen biosynthesis (1/9 steps found)
- Escherichia coli serotype O:183/Shigella boydii serotype O:10 O antigen biosynthesis (1/9 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.5.99.a
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (477 amino acids)
>ABI39_RS16730 lipopolysaccharide biosynthesis protein (Phocaeicola dorei CL03T12C01) MSNSLKQVATKGVLWSSIERFSVQGIQFVIMIIMARLLTPEDYGLVGMLTIFLAVSQSLI DSGFSQALIRKQNRTEVDNSTVFYFNIAVGLALYLLFYISAPWVADFYGLPELSLVMRVV CLGIIFNSLAVVQRALLTVRIDFKTQAKASLIAAVISGMTGIILAYTGFGIWALVCQQLV NLGINTLLLWIFSKWKPMRTYSWKSFRELFSFGSKLLASGLLDTTYNNIYPIVIGKVFSA GDLGHYTRAQQFSVFPSSNITGILQRVTYPVLCSIQNDIDRLRGVYRKFLKLSAYVVFPL MTGLAAVSFPFIRIVLGEKWIFCAVLLQIICFSMMWYPIHAINLNLLQVQGRSDLFLRLE IIKKAIGVSILCLTIPLGLKTMCFGGVVSSLLCLVINTFYTGKLIQVGFIMQMRDLFPTL VVSLLMFVLVFSLQWMTENLYAQLLGGIILGSGFYLAVTRILRFQELQELFSLFSKR