Protein Info for ABI39_RS14990 in Phocaeicola dorei CL03T12C01

Annotation: ATP synthase F0 subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 18 to 80 (63 residues), 62.1 bits, E=2.4e-21
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 27 to 83 (57 residues), 57.1 bits, E=7.4e-20

Best Hits

Swiss-Prot: 100% identical to ATPL_BACV8: ATP synthase subunit c (atpE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 100% identity to bvu:BVU_2997)

MetaCyc: 44% identical to ATP synthase Fo, c subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (84 amino acids)

>ABI39_RS14990 ATP synthase F0 subunit C (Phocaeicola dorei CL03T12C01)
MLLAVLLQSAAAAGLGKLGAALGAAIAVIGAGIGIGKIGGSAMEAIARQPEAAGDIRMNM
IIIAALVEGVALIAIIVCLLTLFL