Protein Info for ABI39_RS14470 in Phocaeicola dorei CL03T12C01

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 13 to 226 (214 residues), 268.8 bits, see alignment E=1.6e-84 PF01243: Putative_PNPOx" amino acids 46 to 132 (87 residues), 78.6 bits, see alignment E=3.3e-26 PF10590: PNP_phzG_C" amino acids 185 to 226 (42 residues), 69.4 bits, see alignment 2e-23

Best Hits

Swiss-Prot: 76% identical to PDXH_BACFR: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 73% identity to pdi:BDI_2095)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>ABI39_RS14470 pyridoxamine 5'-phosphate oxidase (Phocaeicola dorei CL03T12C01)
MKEYRLRVKEKIMKADLATIRREYTKGGLKRSDLPDNPLVLFTKWLQEAIDAEVNEPTAM
LVGTVSPEGKPAIRTVLLKDLHDGKFIFYTNYGSRKGKHLAHNPSISISFVWHELERQIH
IEGIAAKVSPQESDEYFRKRPYKSRIGARISPQSEPIESRIQLIRDFVKETTRWIGKEID
RPEYWGGFAVMPVRVEFWQGRVNRLHDRFLYMLQSDGVWKIERLAP