Protein Info for ABI39_RS14410 in Phocaeicola dorei CL03T12C01

Annotation: tryptophan-rich sensory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details PF03073: TspO_MBR" amino acids 10 to 151 (142 residues), 145.1 bits, see alignment E=6.7e-47

Best Hits

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 92% identity to bvu:BVU_2873)

Predicted SEED Role

"putative outer membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>ABI39_RS14410 tryptophan-rich sensory protein (Phocaeicola dorei CL03T12C01)
MKKIIPILIAILICFGVGCTASYFQSEAILNWYPTLDKPSLTPPDMAFPIAWSLIYLCMG
ISIGLIWHMWTIRRQMIIRLFGFQLLFNFTWSIFFFYLRSPLLGFANILVLDVLVVYYMI
ESYPVKKSSAYLFVPYLLWLILATYLNGYILMYN