Protein Info for ABI39_RS14215 in Phocaeicola dorei CL03T12C01

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details PF01694: Rhomboid" amino acids 48 to 185 (138 residues), 60.1 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 97% identity to bvu:BVU_2773)

Predicted SEED Role

"PROBABLE INTEGRAL MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>ABI39_RS14215 rhomboid family intramembrane serine protease (Phocaeicola dorei CL03T12C01)
MKLEIQKILLAFALPLLLLFILYTLRTMESVMNWDFITWGIYPRETKGIMGIFTSPLIHA
DWGHLFANTFPLLFLLWCLLYFYRDLGIGILFFIWIVSGILTFIIGKPGWHIGASSIIYS
LAFFLFFSGILRKHVPLVALSLLVTFLYGSLVWNMFPQFASSTTSWEGHLGGAAAGIAAA
ILFRHKGPQQPELFIDEEEEDNSSHPENEEVITNPDQEKKND