Protein Info for ABI39_RS13790 in Phocaeicola dorei CL03T12C01

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13412: HTH_24" amino acids 7 to 54 (48 residues), 62.5 bits, see alignment E=6.8e-21 PF13404: HTH_AsnC-type" amino acids 7 to 48 (42 residues), 54 bits, see alignment E=3.5e-18 PF13463: HTH_27" amino acids 9 to 55 (47 residues), 22.7 bits, see alignment E=2.8e-08 PF01047: MarR" amino acids 12 to 56 (45 residues), 27.3 bits, see alignment E=8.3e-10 PF01037: AsnC_trans_reg" amino acids 85 to 147 (63 residues), 70.2 bits, see alignment E=3.4e-23

Best Hits

Swiss-Prot: 38% identical to BKDR_PSEAE: Bkd operon transcriptional regulator (bkdR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to bvu:BVU_2702)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>ABI39_RS13790 Lrp/AsnC family transcriptional regulator (Phocaeicola dorei CL03T12C01)
MSTLEKLDKVDLQILRTLQENARLTTKELAARVSLSSTPVFERLKRLENGGYIKKYIAVL
DAEKLNQGFVVFCSVKLRRLNRDIAAEFTRIIQDIPEVTECYNISGSYDYLLKIHSPNMK
YYQEFILNVLGTIDSLGSLESTFVMNEVKHEYGIHI