Protein Info for ABI39_RS13570 in Phocaeicola dorei CL03T12C01

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13477: Glyco_trans_4_2" amino acids 23 to 129 (107 residues), 46.2 bits, see alignment E=2e-15 PF13579: Glyco_trans_4_4" amino acids 29 to 170 (142 residues), 49.4 bits, see alignment E=2.4e-16 PF13439: Glyco_transf_4" amino acids 29 to 170 (142 residues), 33.5 bits, see alignment E=1.5e-11 PF20706: GT4-conflict" amino acids 198 to 315 (118 residues), 34 bits, see alignment E=5.7e-12 PF13692: Glyco_trans_1_4" amino acids 200 to 338 (139 residues), 110.6 bits, see alignment E=2.6e-35 PF00534: Glycos_transf_1" amino acids 200 to 352 (153 residues), 108.5 bits, see alignment E=9.5e-35 PF13524: Glyco_trans_1_2" amino acids 281 to 362 (82 residues), 26 bits, see alignment E=3e-09

Best Hits

KEGG orthology group: None (inferred from 50% identity to fbc:FB2170_09941)

Predicted SEED Role

"Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>ABI39_RS13570 glycosyltransferase family 4 protein (Phocaeicola dorei CL03T12C01)
MKPKVIRISTVPLSLHLLLQGQLKMLAETYEVLAVSSSGEELHKVAEREGVRTCAIPMER
HIAPLKDLIALIRLIILFRKEKPQIVHSLTPKAGLLAMMAARICRVPIRIHTFTGLVFPS
TTGWKQQLLIATDKLTCACATYLNPEGKGVRRDLERFHITSRALHLIGNGNINGIDLAYF
DRTPEVMRQAEIYRRNPCFTFCFVGRLVRDKGINELVSAFVRLQQEFTNCRLCLVGDFEA
ELDPVTPETAEHIHKHPAIKFMGWQEDIRPFLAAADAFVFPSYREGFPNVILQAGAMGLP
CIVTNINGCNEIIENGKNGIIIPPHDSEYLYRTMCGFLSSPRLVEQLASAARPQIVQKYD
RRTLWEALRKVYQEQISNLTK