Protein Info for ABI39_RS13150 in Phocaeicola dorei CL03T12C01

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 67 to 364 (298 residues), 291.2 bits, see alignment E=4.9e-91 PF00595: PDZ" amino acids 103 to 172 (70 residues), 31.1 bits, see alignment E=3.7e-11 PF13180: PDZ_2" amino acids 104 to 182 (79 residues), 43.8 bits, see alignment E=3.9e-15 PF03572: Peptidase_S41" amino acids 204 to 361 (158 residues), 180.9 bits, see alignment E=2.2e-57

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 99% identity to bvu:BVU_2624)

Predicted SEED Role

"Carboxy-terminal processing protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>ABI39_RS13150 S41 family peptidase (Phocaeicola dorei CL03T12C01)
MSKNRTSRFMPVIVAVSIVAGILIGTFYANHFSGNKLGIINTSSNKLNALLRIIDDQYVD
TVNMGELVEDAMPQILGELDPHSSYIPAKDLEAVNSDLKGSFSGIGIQFTIQQDTIHVNS
VIQGGPSEKVGLMAGDRIIEVDDSAFVGKIVTNYESMKRLKGPKGSEVKLGVFRPGEKET
LHFTIVRGDIPVKSVDAAYMLNDKFGYIKVNKFGETTYPELLISLAKLNQANCEGVVIDL
RGNTGGYMGAAIQMVNEFLPKNRLIVYTQGRKSPRENYTSNGTGSSQKMPIVVLMDEGSA
SASEIFAGAIQDNDRGTIIGRRSFGKGLVQQPIDFSDGSAIRLTIARYYTPSGRCIQKPY
VKGNDANYEMDILTRYEHGEFFSQDSIKQDQSQIFETSLGRPVYGGGGIMPDIFVPQDTT
GVTSYYRMSVNRGLTIQFAFQYTDNHRAEMQKYETEESLLQYLKHQNILEQFARFAESKG
LKRRNILMYKSQKLFETNLYGNIIYNMLGMEAYIEYLNKSDKTVLKALEVLDKGESFPKA
PEQPIEPKVSDEGTKKTTAQADSARKTPSRHHRINDKVRCFA