Protein Info for ABI39_RS13125 in Phocaeicola dorei CL03T12C01

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 22 to 157 (136 residues), 159.9 bits, E=2e-51
• PF00885: DMRL_synthase
  • amino acids 22 to 159 (138 residues), 180.4 bits, E=8.8e-58

Best Hits

Swiss-Prot: 95% identical to RISB_BACV8: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 95% identity to bvu:BVU_2618)

MetaCyc: 45% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Protein Sequence (168 amino acids)

>ABI39_RS13125 6,7-dimethyl-8-ribityllumazine synthase (Phocaeicola dorei CL03T12C01)
MATAYHNLSDYDFNSVPNAENMRFGIVVSEWNSNITGPLLEGAVTTLKKHGAKDENILVQ
TVPGSFELTFGSAQMIKSGKVDAVIAIGCVVRGDTPHFDYVCAGTTQGIAQLNAEGDIPV
IYGLITTNTMQQAEDRAGGKLGNKGDECAITAIKMLDFKQKVQGKQIF