Protein Info for ABI39_RS12160 in Phocaeicola dorei CL03T12C01

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 15 to 29 (15 residues), see Phobius details amino acids 35 to 36 (2 residues), see Phobius details amino acids 48 to 82 (35 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details amino acids 414 to 437 (24 residues), see Phobius details PF01554: MatE" amino acids 22 to 181 (160 residues), 98.2 bits, see alignment E=4.3e-32 amino acids 246 to 406 (161 residues), 82.1 bits, see alignment E=3.8e-27 TIGR00797: MATE efflux family protein" amino acids 22 to 419 (398 residues), 201.3 bits, see alignment E=1.2e-63 PF14667: Polysacc_synt_C" amino acids 136 to 272 (137 residues), 41.5 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_2421)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>ABI39_RS12160 MATE family efflux transporter (Phocaeicola dorei CL03T12C01)
MLSKIDLTQGGITGTLLRFTLPMIIGSLLQQCYNIADTLIVGQCIGSGALAAVGSAYTLM
VFLISILLGLSMGSGTVFSLQYGAGRTDSLRRNIYVSALLIGTVTLILNIAAFVWIHPIL
RLLQIPKDIYGMMYDYLWIIFWGIGFTFIYNFYAALLRAIGDAVTPLWFLAVSVVLNIGL
DLFFILQLDWGIKGAAIATVAAQGVSALGIMGYAYVKYPELRLHRNDLHFDRHCLKEITS
FSALTCVQQSVMNLGILMVQGLVNSFGTVVMAAFAAAIKIDSFAYMPVQEFGNAFSTFIA
QNFGARKEERIRKGVKSALITTVLFSLVISILVFLFAKPLMLIFVRPHETEILNIGISYL
RIEGAFYCGIGILFLLYGYYRAIRMPGMSVVLTVVSLGTRVALSYWLAGIPAIGVIGIWW
SIPIGWFIADVIGIIYYKQLKKETAKEVPAP