Protein Info for ABI39_RS11770 in Phocaeicola dorei CL03T12C01

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details PF02687: FtsX" amino acids 300 to 416 (117 residues), 43.5 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 98% identity to bvu:BVU_2350)

Predicted SEED Role

"ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABI39_RS11770 FtsX-like permease family protein (Phocaeicola dorei CL03T12C01)
MNRNLLKQIWNERRSNAFLWMELFVVFVILWYIVDVVYVTLSIYNLPMGFDIENTYVLRF
ERMTSKAAAYQPGRTMKEDVADLHEIVNRLAHRPDVEAVSLSQNCIPYNDGANSFSFYLD
TVPVRSLKRWITPEYFNVFRYRNIDGSDSESLAEALTPSGMVLSVNIADVYQDAPWHGKE
LLGRRVPVWRNEPEAEHLSIAALTEPVRYDHFTAPDDYGSRYAAVYLTDEVMESLGETVY
IEVCLRVREGQNDGFIDRLIVDADRQYQVGNLYLLDITPLSDVRTAYETDSVNELNTQFC
IIFFLLLNIFLGIIGTFWFRTQHRRVEIALRIALGSTRWGICGRLMGEGVFLLLVSAIPA
LVVAWNLGYAELVEVTRMPFTEGRFAITILGTFILIAGMIVIGIGYPARRAMSIEPAEAL
HEE