Protein Info for ABI39_RS11500 in Phocaeicola dorei CL03T12C01

Annotation: glycoside hydrolase family 25 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details PF01183: Glyco_hydro_25" amino acids 91 to 265 (175 residues), 170.7 bits, see alignment E=2.1e-54

Best Hits

KEGG orthology group: K07273, lysozyme (inferred from 97% identity to bvu:BVU_2287)

Predicted SEED Role

"Lyzozyme M1 (1,4-beta-N-acetylmuramidase) (EC 3.2.1.17)" (EC 3.2.1.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>ABI39_RS11500 glycoside hydrolase family 25 protein (Phocaeicola dorei CL03T12C01)
MVRAKSTRPAPVKKKAAAKPVRRATQRKAKKKPQRQMPSWLRYVIAGLIAFLFLAAFFYF
FIRPYSYRWKPCYGFKAYGVCMPSGFQVHGIDVSHYQGNIDWKMLTHTRQGKFPIHFVFM
KASEGGDYGDKAFITNFDSAKTHGFIRGAYHFYNPKTDPIRQADFFINSVKLDSGDLPPV
LDIEKRGKDENQLRRDLKLWLDKIEQHYKVKPILYTSYKFKTRYLNDSVFNSYPYWIAHY
YVDSVEYRGEWKFWQHTDVGTLPGIREKVDLNIFNGSLEELQLMTIKK