Protein Info for ABI39_RS11255 in Phocaeicola dorei CL03T12C01

Annotation: phenylalanine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF02912: Phe_tRNA-synt_N" amino acids 19 to 80 (62 residues), 67.9 bits, see alignment E=5.9e-23 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 38 to 341 (304 residues), 306.5 bits, see alignment E=1.2e-95 PF01409: tRNA-synt_2d" amino acids 87 to 340 (254 residues), 316 bits, see alignment E=1.7e-98

Best Hits

Swiss-Prot: 99% identical to SYFA_BACV8: Phenylalanine--tRNA ligase alpha subunit (pheS) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 99% identity to bvu:BVU_2237)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>ABI39_RS11255 phenylalanine--tRNA ligase subunit alpha (Phocaeicola dorei CL03T12C01)
MLAKIEQLLQEIEGLQAANAEELEALRIKYLSKKGAINELMADFRNVPAEQKKEVGMKLN
ELKNKAQERIATLKEVFETQDNGAAEMDLTRTAYPIELGTRHPLSIVKNEIIDIFHRLGF
SIADGPEIEDDLHVFTAMNFAEDHPARDMQDTFFIEASQEDVKKNIVLRTHTSSVQARAM
EHSQPPIRIICPGRVYRNEAISYRAHAFFHQVEALYIDKNVSFTDLKQVLLLFAKEMFGE
DTQIRLRPSYFPFTEPSAEMDISCNICGGKGCPFCKGTGWVEILGCGMVDPNVLEANGID
SKVYSGYALGMGIERITNLKYRVNDLRLFSENDTRFLKEFEAAN