Protein Info for ABI39_RS09735 in Phocaeicola dorei CL03T12C01

Annotation: 5'/3'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 8 to 242 (235 residues), 163.1 bits, E=3.9e-52
• PF01975: SurE
  • amino acids 8 to 190 (183 residues), 188 bits, E=8.1e-60

Best Hits

Swiss-Prot: 98% identical to SURE_BACV8: 5'-nucleotidase SurE (surE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 98% identity to bvu:BVU_1916)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• ureide biosynthesis (3/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (2/6 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• purine nucleotides degradation I (plants) (5/12 steps found)
• NAD salvage (plants) (4/11 steps found)
• tunicamycin biosynthesis (1/9 steps found)
• superpathway of purines degradation in plants (5/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Protein Sequence (257 amino acids)

>ABI39_RS09735 5'/3'-nucleotidase SurE (Phocaeicola dorei CL03T12C01)
MKREKPLILLSNDDGVEAKGLNELIRGLRGVGEMIVMAPDGPRSGASGAITSEHPVRYYK
VREEEDLTVYKCTGTPVDCVKLALHTVVPRRPDVVIGGINHGDNSSVNVHYSGTMGVVIE
GCLKGISSIGYSLCNHFADADFSSSLPYIRRITEQVLEHGLPLGICLNVNFPDTASLKGV
RICRQTNGAWINEWKRSLHPRGGEYFWLTGEFDNYEPEAEDSDHWALGHGYVAVTPTQID
VTAYGMMNELKNWNLEV