Protein Info for ABI39_RS09600 in Phocaeicola dorei CL03T12C01

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 transmembrane" amino acids 8 to 27 (20 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 71 to 457 (387 residues), 216.7 bits, see alignment E=2.3e-68

Best Hits

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>ABI39_RS09600 cation:proton antiporter (Phocaeicola dorei CL03T12C01)
MRKARKNYFIYLMMLLIFGGLIYTAIAGGERFLHLSSIKPATAGDDAFTMFKTILLDNLE
HPFSILLIQIIVVLIAVRIFASAFRYIGQPGVIGEIVAGIVLGPSLLGSLYPEFFGFLFQ
PDSLTNLELISQLGLVLFMFVIGMEVDFGVLKNKINETLVISHAGILVPFFLGMLASYWV
YEEYASQQTAFLPFALFIGISMSITAFPVLARIIQERNMTRKPVGILTIASAANDDVTAW
CLLAVVIAITKAGTLGGALYTVLLTFVYIAVMFVVVRPFLKKIGTLYSNKEVINKTFVSF
IFLVLIVSAAITEILGIHALFGAFMAGVVMPSNFGFRKVMMEKVEDIALVFFLPLFFAFT
GLRTQIGLINTPELWCVCLLLITVAVVGKFGGCAVASRLVGESWKDSFTIGTLMNTRGLM
ELVALNIGYELGVLPPSIFVILIIMALVTTFMTTPLLNLVEWGFAVREQKTVLQRKLLLF
FGRPETGGKLLSVYKLLFGKQLSYHQVIAAHYTTGTDVNPTSVEQFFEESFIPVDKQAEH
LNIHIEKRYRVTDNLVSDMISTVEAESPDILLLGAGPCFMTDGEKSMTSFFGLFRKKVDD
VLEHASCPVAIFVNRDYRNGDEVAVLINGSMDSFLFTYVRRLLEDGGSFIHLYYFSSGSE
EYVGQIYKINKQYANRVHLYPLVEIEDLVLPIIHGLLILSYDTCVGIAANEKVFKALPSL
LVMKDAS