Protein Info for ABI39_RS08820 in Phocaeicola dorei CL03T12C01

Annotation: conjugative transposon protein TraJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details TIGR03782: Bacteroides conjugative transposon TraJ protein" amino acids 2 to 325 (324 residues), 600.5 bits, see alignment E=3.3e-185 PF07863: CtnDOT_TraJ" amino acids 272 to 329 (58 residues), 58.4 bits, see alignment E=4.6e-20

Best Hits

KEGG orthology group: None (inferred from 95% identity to bsa:Bacsa_2555)

Predicted SEED Role

"Conjugative transposon protein TraJ" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABI39_RS08820 conjugative transposon protein TraJ (Phocaeicola dorei CL03T12C01)
MEFDNLHQILRSLYEQMMPLCEDMAGVAKGIAGLGALFYVAYRVWQSLARAEPIDVFPML
RPFAIGLCIMFFPTVVLGTINSILSPVVQGTAKMLEAETLDMNTYRQQKDKLEYEAMMRN
PETAYLVSNEEFDKQLEELGWSPSDMVTMAGMYIDRGMYNMKKNIRDFFREILELLFQAA
ALVIDTVRTFFLVVLAILGPIAFAISVWDGFQSTLTQWICRYIQVYLWLPVSDMFSTILA
KIQVLMLQSDIERMQADPNFSLDSSDGVYIVFLCIGIIGYFTIPTVAGWIIQAGGMGSYN
RNMNQMAGRAGGMAGGVAGATAGNAVGRIGKLLK