Protein Info for ABI39_RS08550 in Phocaeicola dorei CL03T12C01

Annotation: TrkH family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 394 to 418 (25 residues), see Phobius details amino acids 456 to 477 (22 residues), see Phobius details PF02386: TrkH" amino acids 45 to 479 (435 residues), 226.1 bits, see alignment E=3.7e-71

Best Hits

Swiss-Prot: 38% identical to TRKH_HALED: Trk system potassium uptake protein TrkH (trkH) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 95% identity to bvu:BVU_1761)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>ABI39_RS08550 TrkH family potassium uptake protein (Phocaeicola dorei CL03T12C01)
MINTKMIARIMGSLFFIEAGFLILCSFLAVYYNESDLSAFLTSTAITVGAGIIASLTGKN
AEKKISRRDGYVIVTFAWVFFSLFGMLPFYLSGYIPCITDAFFETMSGFTTTGASILNNI
ESLPHGLLFWRSMTQWIGGLGIVFFTIAVLPIFGVGSVQLFAAEATGPTHDKVHPRIGVT
AKWIWTIYLGLTIAEIILLIAGGMDFFDSVCHSLTTAATGGYSTKQNSIAFFNSPYIEYV
ITLFMFLSGINFTLLYLLFLKGNFKRLFQNTELHWYLGTVGFFTLFTTVTLIFTSPFSIE
ESFRKAIFQVVSLQTTTGFISADYMTWVPVLWTLMCIIMLFGACAGSTTGGIKCIRIAIM
SRISKNEFKHIIHPNAILPVRINHQVVSSTTKSAVLAFIFLYMAIIFIGWLVLMLFGVGF
EEAYSVVISSLGNVGPGIGKCGPSYSWSGLPDAAKWTSAILMLIGRLELFTVLLLFMPSF
WKKH