Protein Info for ABI39_RS07830 in Phocaeicola dorei CL03T12C01

Annotation: helix-hairpin-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details PF12836: HHH_3" amino acids 83 to 140 (58 residues), 34.7 bits, see alignment E=1.7e-12 amino acids 174 to 225 (52 residues), 44 bits, see alignment 2e-15 amino acids 237 to 297 (61 residues), 47 bits, see alignment E=2.3e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to bvu:BVU_1491)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABI39_RS07830 helix-hairpin-helix domain-containing protein (Phocaeicola dorei CL03T12C01)
MWKDFFYFSKSERRAILFLLTLLFIFMCIWVLFPVKEESLEQDQEGIEEIKNFLAGVHEM
EEKESLQYSYDKPKRIEVVLAAFDPNSADSIEFLQCGLPPFIAHTILQYRRAGGKFRTAD
DFSRVYGLSSEKFNILKPYIQISEAFRRKQDTLHFIKKVEKDTLAAYKYPEGTLVDLSEA
DTTELKKIPGIGSGIARMIVAYRKRLGGFYDTVQLKEVNYVDEDMLKWFKLGNTPIHRIN
ANKAGLDKLRSHPYMNFYQAKVIIEYRRKKGKLKSLSQLSLYEEFTEKDLERLSHYLAFD