Protein Info for ABI39_RS06625 in Phocaeicola dorei CL03T12C01

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details PF08551: DUF1751" amino acids 47 to 113 (67 residues), 32 bits, see alignment E=1.6e-11 PF01694: Rhomboid" amino acids 48 to 217 (170 residues), 117.2 bits, see alignment E=6.8e-38

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_0995)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>ABI39_RS06625 rhomboid family intramembrane serine protease (Phocaeicola dorei CL03T12C01)
MNSIPTVTKNLLIINVLCFFGGVVAMKYGINLNDLLGLHFFMASDFNPAQLITYMFMHGG
FQHIFFNMFALWMFGRTLEQVWGPKRFLFYYMVCGIGAGLVQELVQYIQYVTELSQYDSV
NTGIAVIPMAEYLNLMTTVGASGAIYGILLAFGMLFPNSQMFVFPIPFPVKAKYFVMGYA
ALEIFLGLGASTDGVAHFAHLGGMIFGFILIMYWRKKNNNGQFYY