Protein Info for ABI39_RS06430 in Phocaeicola dorei CL03T12C01

Annotation: DUF2062 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 227 to 246 (20 residues), see Phobius details amino acids 277 to 303 (27 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 364 to 389 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 18 to 102 (85 residues), 33.3 bits, see alignment E=7e-12 PF00535: Glycos_transf_2" amino acids 20 to 137 (118 residues), 91.5 bits, see alignment E=9.1e-30 PF09835: DUF2062" amino acids 266 to 393 (128 residues), 80.6 bits, see alignment E=1.8e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_1029)

Predicted SEED Role

"glycosyl transferase, family 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>ABI39_RS06430 DUF2062 domain-containing protein (Phocaeicola dorei CL03T12C01)
MNTNTTSVWRKKLKELEIVVVIPTYNNGKTLAAVIEEVYRYADDIIVINDGSTDDTANIL
EQYPAIRTITHPVNKGKGTALKHGLSQAKKEGFRYAITIDSDGQHFASDIPCFIEAIEKE
PDTLLVGARNLASDNMPGKNTFANKFSNFWFRLETGLKLEDTQSGYRLYPLRKMDVQSCW
YTAKYEFELEAIVFAAWGDVVVKNIPIHVYYPPQAERVSHFRPFRDFTRISVLNTVLVLI
TCLWIIPRNLLRKLSWSNCKRFFTDNVLNTRESNLKIVLAIMLGIFMGIVPLWGYQMLIT
LFLAHLFRLNKVIALVAANISIPPMIPLLLYGSYRTGCMVLGNPPDLHLGDLSLENVKSV
LEQYLIGSIIFAMACSLLSGVISTALLAICRRKNGYD