Protein Info for ABI39_RS05840 in Phocaeicola dorei CL03T12C01

Annotation: TolC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02321: OEP" amino acids 28 to 216 (189 residues), 106.2 bits, see alignment E=9.6e-35 amino acids 245 to 424 (180 residues), 74 bits, see alignment E=6.9e-25

Best Hits

KEGG orthology group: None (inferred from 71% identity to bsa:Bacsa_3724)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABI39_RS05840 TolC family protein (Phocaeicola dorei CL03T12C01)
MKKLIVAAVAAIVFIANIQAQNKKWSFKECIDYAILHNIEVKQSQNRIKSLKVERNTLKS
SFLPDLNVGASQRFSFGRALNQDNTYEDSNIQNSSFSASAEMPLFTGFKTSASITRNKFD
ILAAEANKELIENNLSLNVTNYYFQILLNKEIYRIAQEQIRLTKEQEIRTRILIENGKVP
QSQLYDVKAQLADDELVATEARNSLRLSFLDLMQLMELKGEEYFDVDSLDESIVSMESVT
PEGIYASALSCMPQIKQAHYSLQSKVKSTKVVKSGYYPQLFLGVGINTGYYYSRRAMNPS
FYQQFKNNMQKSIYFTLSIPLFDRFSTRNQVKTARLEENNARLSLENEKKSLYKDIEKAY
MDALAAFEKYESTTKAVAANREAHRYALEKYMAGKSAVYEYNEIKMKLADALSQQSQTKY
TYLLKERILAFYSCHSLVE