Protein Info for ABI39_RS05755 in Phocaeicola dorei CL03T12C01

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 21 to 325 (305 residues), 394.2 bits, E=2e-122
• PF02445: NadA
  • amino acids 25 to 323 (299 residues), 414.5 bits, E=1.1e-128

Best Hits

Swiss-Prot: 55% identical to NADA_CHLT3: Quinolinate synthase A (nadA) from Chloroherpeton thalassium (strain ATCC 35110 / GB-78)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 97% identity to bvu:BVU_1145)

MetaCyc: 42% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• aspartate superpathway (19/25 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Protein Sequence (330 amino acids)

>ABI39_RS05755 quinolinate synthase NadA (Phocaeicola dorei CL03T12C01)
MNKEEWLKKGYVTEPVDKTLDLKTEIDKLRKEKNALILGHYYQSGEIQDIADFVGDSLAL
AQWAAKTDADIIVMCGVHFMGETAKILCPDKKVLVPDLNAGCSLADSCPADEFAKFVKEH
PDHTVISYVNTTAAVKAVTDVVVTSTNAKQIVDSFPADEKIIFGPDRNLGNYINSITGRD
MLLWDGACHVHEQFSVEKILELKKQYPNAAILVHPECKGAVSKLADKVASTAGLLKYAIT
SDKKDFIVATESGILHEMRKKCPEKNFIPAPPEDSTCACNECNFMRLNTMEKLYNTLKYE
WPEVAVDEAIAEEAVKPIKKMLEISEKLGL