Protein Info for ABI39_RS05640 in Phocaeicola dorei CL03T12C01

Annotation: PspC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 34 to 57 (24 residues), see Phobius details PF04024: PspC" amino acids 4 to 61 (58 residues), 88.1 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_1167)

Predicted SEED Role

"FIG00409837: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (78 amino acids)

>ABI39_RS05640 PspC domain-containing protein (Phocaeicola dorei CL03T12C01)
MENKKLTRSNNRMLAGVCAGLADYFGWDVTIVRIIYSFATVFTAFSGIIVYIILWIVMPE
KKYRDGYEDRMNDRLHNR