Protein Info for ABI39_RS04680 in Phocaeicola dorei CL03T12C01

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF04542: Sigma70_r2" amino acids 14 to 70 (57 residues), 51.3 bits, see alignment E=1.6e-17 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 160 (146 residues), 98.4 bits, see alignment E=1.8e-32 PF08281: Sigma70_r4_2" amino acids 105 to 157 (53 residues), 66.2 bits, see alignment E=3.3e-22 PF04545: Sigma70_r4" amino acids 112 to 159 (48 residues), 48.8 bits, see alignment E=8e-17 PF00196: GerE" amino acids 114 to 158 (45 residues), 27.2 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to bvu:BVU_1339)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>ABI39_RS04680 RNA polymerase sigma factor (Phocaeicola dorei CL03T12C01)
MREISFRNDILPLKDKLYRLALRITLNSAEAEDVVQDTMIRVWNKRDEWPQFESIEAYCL
TIARNLAIDRSQKMEAQNLELTSEVREMPDTLTPYDRLAQNEQIQLVHRLVNELPERQRT
IMQLRDVEGKSYKEIADILQITEEQVKVTLFRARQKIKQRYTEIEDYGL