Protein Info for ABI39_RS03850 in Phocaeicola dorei CL03T12C01

Annotation: gamma carbonic anhydrase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 12 to 46 (35 residues), 39.2 bits, 3.6e-14
  • amino acids 90 to 123 (34 residues), 32.6 bits, 4.5e-12
• PF21711: DCTN5
  • amino acids 31 to 160 (130 residues), 30.9 bits, E=2.1e-11

Best Hits

Swiss-Prot: 49% identical to YTOA_BACSU: Uncharacterized transferase YtoA (ytoA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_0829)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Protein Sequence (174 amino acids)

>ABI39_RS03850 gamma carbonic anhydrase family protein (Phocaeicola dorei CL03T12C01)
MALIKSVRGFTPKIGENCYLADNATIIGDVVIGKDCSIWFNAVLRGDVNAIRIGNRVNIQ
DGSVVHTLYQKSVVEIGNDVSVGHNVTIHGATIKDGALIGMGSTVLDHAVIGEGAIVAAG
ALVLSNTVIEPGSLWAGVPAKFVKKIPEAQSKELNQKIANGYLMYASWFKEEEK