Protein Info for ABI39_RS02415 in Phocaeicola dorei CL03T12C01

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 45% identity to bth:BT_1569)

Predicted SEED Role

"FIG00407680: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>ABI39_RS02415 hypothetical protein (Phocaeicola dorei CL03T12C01)
MEERKLNEKESLELIAQMIQNTKNRLETNCGMPFLFWGYTTIFVSLLVWFLVVTTRNYYW
QYLWFLLPIIAGTGTYLSTRNQQPGIKTHLDKVINYIWLVFGITGFLISMLAMFFWQLPI
LFMVLLLMGMGTTLTGLVIGYKTVTICGTLGALSSIGCLFYPGLNQILIFAPVFIFMMVI
PGHVLNHAARKQKKS