Protein Info for ABI39_RS02370 in Phocaeicola dorei CL03T12C01

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 309 to 328 (20 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 5 to 327 (323 residues), 363.5 bits, see alignment E=4.5e-113 PF00108: Thiolase_N" amino acids 53 to 155 (103 residues), 26.6 bits, see alignment E=5.7e-10 PF08545: ACP_syn_III" amino acids 110 to 188 (79 residues), 97.6 bits, see alignment E=4.9e-32 PF08541: ACP_syn_III_C" amino acids 241 to 327 (87 residues), 108.9 bits, see alignment E=1.7e-35

Best Hits

Swiss-Prot: 100% identical to FABH_BACV8: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to bvu:BVU_0452)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABI39_RS02370 ketoacyl-ACP synthase III (Phocaeicola dorei CL03T12C01)
MEKINAVITGVGGYVPDYVLTNEEISRMVDTNDEWIMTRIGVKERRILNEEGLGTSYMAR
KAAKQLMQKTASNPDDIDAVIVATTTPDYHFPSTASILCDKLGLKNAFAFDLQAACCGFL
YLMETAASLIASGRHKKIIIVGADKMSSMVNYQDRATCPIFGDGAAACMVEATTEDYGIM
DSILRTDGKGLPFLHMKAGGSVCPPSYFTVDHKMHYLYQEGRTVFKYAVSNMSDITATIA
EKNGLNKDNIDWVIPHQANLRIIDAVASRLEVPLEKVMINIQRYGNTSGATLPLCLWDYE
KQLKKGDNLIFTAFGAGFTYGAVYVKWGYDGSKR