Protein Info for ABI39_RS01815 in Phocaeicola dorei CL03T12C01

Annotation: glutamate formimidoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02024: glutamate formiminotransferase
  • amino acids 4 to 299 (296 residues), 425.3 bits, E=5e-132
• PF07837: FTCD_N
  • amino acids 6 to 181 (176 residues), 257.3 bits, E=6.8e-81
• PF02971: FTCD
  • amino acids 184 to 289 (106 residues), 104.5 bits, E=5e-34

Best Hits

Swiss-Prot: 52% identical to GLFT_STRP1: Glutamate formimidoyltransferase (M5005_Spy1772) from Streptococcus pyogenes serotype M1

KEGG orthology group: K00603, glutamate formiminotransferase [EC: 2.1.2.5] (inferred from 98% identity to bvu:BVU_0334)

Predicted SEED Role

"Glutamate formiminotransferase (EC 2.1.2.5) @ Glutamate formyltransferase" (EC 2.1.2.5)

MetaCyc Pathways

• L-histidine degradation III (6/6 steps found)

KEGG Metabolic Maps

• Histidine metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.5

Protein Sequence (300 amino acids)

>ABI39_RS01815 glutamate formimidoyltransferase (Phocaeicola dorei CL03T12C01)
MNWTKIMECVPNFSEGRDLQKIDEIVSPFRAKAGVKLLDYSNDEDHNRLVVTVVGEPDAL
KEAVIEAIGIAVELIDLNHHQGQHPRMGAVDVVPFIPIKECTMEDAIAVSKEVGQRVASQ
YNLPVFLYEKSASAPHRENLAVIRKGEFEGMKEKIHQPEWHPDFGPAERHPTAGTVAIGA
RMPLVAYNINLNTPSLEIAHDIAKKIRFIGGGLRYCKAMGVELKDRGITQVSMNLTDYSK
TAIYRAFEMVRFEAKRYGVSIIGSEIVGLVPMEALIDTASYYLGLENFSMQQVLEARIME